Recombinant Human S100-A12 Protein

Size

£240.00

SKU:: RP00009
Additional Names:: S100A12,CAAF1,CAGC,CGRP,ENRAGE,MRP-6,MRP6,p6
Molecular Weight:: Approximately 14 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Glu92
Formulation:: Recombinant Human S100-A12 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100A12 (Accession #NP_005612.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Uniprot:: P80511
Synonyms:: CAAF1;CAGC;calcitermin;calcium-binding protein in amniotic fluid 1;calgranulin C;Calgranulin-C;CGRP;EN-RAGE;ENRAGE;extracellular newly identified RAGE-binding protein;migration inhibitory factor-related protein 6;MRP-6;MRP6;neutrophil S100 protein;p6;protein S100-A12;S100 calcium-binding protein A12
Extra Details:: The protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 proteins include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity.

Shipping Conditions:: Blue Ice