FTSJ3 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9994
Additional Names:: EPCS3|FTSJ3|SPB1
Application:: ELISA, WB
Molecular Weight:: 125kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKHRILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDISEREKVAQLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQKKKHKRK
Uniprot:: Q8IY81
Synonyms:: 2'-O-ribose RNA methyltransferase SPB1 homolog;EPCS3;FtsJ homolog 3;FtsJ RNA methyltransferase homolog 3;pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3;pre-rRNA processing protein FTSJ3;protein ftsJ homolog 3;putative rRNA methyltransferase 3;rRNA (uridine-2'-O-)-methyltransferase 3;SPB1;SPB1 RNA methyltransferase homolog
Extra Details:: Although the function of this gene is not known, the existence of this gene is supported by mRNA and EST data. A possible function of the encoded protein can be inferred from amino acid sequence similarity to the E.coli FtsJ protein and to a mouse protein possibly involved in embryogenesis.