SOCS6 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9957
Additional Names:: CIS-4|CIS4|HSPC060|SOCS-4|SOCS-6|SOCS4|SOCS6|SSI4|STAI4|STATI4
Application:: ELISA, WB, IHC-P
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVP
Uniprot:: O14544
Synonyms:: CIS-4;CIS4;cytokine-inducible SH2 protein 4;HSPC060;SOCS-4;SOCS-6;SOCS4;SSI4;STAI4;STAT induced STAT inhibitor-4;STATI4;suppressor of cytokine signaling 4;suppressor of cytokine signaling 6
Extra Details:: The protein encoded by this gene contains a SH2 domain and a CIS homolog domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by GM-CSF and EPO in hematopoietic cells. A high expression level of this gene was found in factor-independent chronic myelogenous leukemia (CML) and erythroleukemia (HEL) cell lines.

Shipping Conditions:: Blue Ice