A9944
SERPINB6 Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A9944
- Additional Names:
- CAP|DFNB91|MSTP057|PI-6|PI6|PTI|SERPINB6|SPI3
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA
- Uniprot:
- P35237
- Synonyms:
- CAP;cytoplasmic antiproteinase;DFNB91;MSTP057;Peptidase inhibitor 6;PI-6;PI6;Placental thrombin inhibitor;protease inhibitor 6 (placental thrombin inhibitor);PTI;serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 6;serpin B6;serpin peptidase inhibitor, clade B (ovalbumin), member 6;SPI3
- Extra Details:
- The protein encoded by this gene is a member of the serpin (serine proteinase inhibitor) superfamily, and ovalbumin(ov)-serpin subfamily. It was originally discovered as a placental thrombin inhibitor. The mouse homolog was found to be expressed in the hair cells of the inner ear. Mutations in this gene are associated with nonsyndromic progressive hearing loss, suggesting that this serpin plays an important role in the inner ear in the protection against leakage of lysosomal content during stress, and that loss of this protection results in cell death and sensorineural hearing loss. Alternatively spliced transcript variants have been found for this gene.
- Shipping Conditions:
- Blue Ice

_WB_01.jpg)