MT-ND4 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9941
Additional Names:: MT-ND4|ND4
Application:: ELISA, WB
Molecular Weight:: 51 kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LMASLANLALPPSINLMGELFITMSLFSWSNFTIILMGINIIITGMYSMYMIITTQRGKLTNHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLTM
Synonyms:: MTND4;NADH dehydrogenase subunit 4
Extra Details:: Predicted to enable NADH dehydrogenase (ubiquinone) activity and ubiquinone binding activity. Predicted to contribute to NADH dehydrogenase activity. Predicted to be involved in several processes, including electron transport coupled proton transport; mitochondrial electron transport, NADH to ubiquinone; and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Parkinson's disease; macular degeneration; and schizophrenia. Orthologous to human MT-ND4 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4).