MT-ND3 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9940
Additional Names:: MT-ND3|ND3
Application:: ELISA, WB
Molecular Weight:: 13kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MNLYTVIFINILLSLTLILVAFWLPQMNLYSEKANPYECGFDPTSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQTIKTSTMMIMAFILVTILSL
Synonyms:: MTND3;NADH dehydrogenase subunit 3
Extra Details:: Predicted to enable NADH dehydrogenase (ubiquinone) activity. Predicted to be involved in cellular response to glucocorticoid stimulus; mitochondrial electron transport, NADH to ubiquinone; and response to oxidative stress. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; genitourinary system; hemolymphoid system gland; and liver and biliary system. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Leigh disease; and Parkinson's disease. Orthologous to human MT-ND3 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 3).