KCNJ6 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9935
Additional Names:: BIR1|GIRK-2|GIRK2|hiGIRK2|KATP-2|KATP2|KCNJ6|KCNJ7|KIR3.2|KPLBS
Application:: ELISA, WB
Molecular Weight:: 48kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNVRETYRYLTDI
Uniprot:: P48051
Synonyms:: BIR1;G protein-activated inward rectifier potassium channel 2;GIRK-2;GIRK2;hiGIRK2;inward rectifier K(+) channel Kir3.2;inward rectifier potassium channel KIR3.2;KATP-2;KATP2;KCNJ7;KIR3.2;KPLBS;Potassium channel, inwardly rectifying subfamily J member 6;potassium channel, inwardly rectifying subfamily J, member 6;potassium voltage-gated channel subfamily J member 6
Extra Details:: This gene encodes a member of the G protein-coupled inwardly-rectifying potassium channel family of inward rectifier potassium channels. This type of potassium channel allows a greater flow of potassium into the cell than out of it. These proteins modulate many physiological processes, including heart rate in cardiac cells and circuit activity in neuronal cells, through G-protein coupled receptor stimulation. Mutations in this gene are associated with Keppen-Lubinsky Syndrome, a rare condition characterized by severe developmental delay, facial dysmorphism, and intellectual disability.

Shipping Conditions:: Blue Ice