ITGAE Rabbit polyclonal antibody

Size

£151.00

SKU:: A9934
Additional Names:: CD103|HUMINAE|ITGAE
Application:: ELISA, WB
Molecular Weight:: 25kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRALEKEEEEDKEEEEDEEEEEAG
Uniprot:: P38570
Synonyms:: antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide;CD103;HML-1 antigen;human mucosal lymphocyte antigen 1, alpha polypeptide;HUMINAE;integrin alpha-E;integrin alpha-IEL;integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide);mucosal lymphocyte 1 antigen
Extra Details:: Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation.

Shipping Conditions:: Blue Ice