A9899
CAMKK2 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9899
- Additional Names:
- CAMKK|CAMKK2|CAMKKB
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 68kDa/70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLS
- Uniprot:
- Q96RR4
- Synonyms:
- calcium/calmodulin-dependent protein kinase beta;calcium/calmodulin-dependent protein kinase kinase 2;calcium/calmodulin-dependent protein kinase kinase 2, beta;Calcium/calmodulin-dependent protein kinase kinase beta;caM-kinase kinase 2;caM-kinase kinase beta;caM-KK 2;caM-KK beta;CAMKK;CAMKK beta protein;CAMKKB
- Extra Details:
- The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases.
- Shipping Conditions:
- Blue Ice