A9892
STRA13 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9892
- Additional Names:
- CENP-X|D9|FAAP10|MHF2|STRA13
- Application:
- ELISA, WB
- Molecular Weight:
- 14kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF
- Uniprot:
- A8MT69
- Synonyms:
- CENP-X;centromere protein X;D9;FAAP10;FANCM associated histone fold protein 2;FANCM-associated histone fold protein 2;FANCM-interacting histone fold protein 2;Fanconi anemia-associated polypeptide of 10 kDa;MHF2;retinoic acid-inducible gene D9 protein homolog;stimulated by retinoic acid 13 homolog;stimulated by retinoic acid gene 13 protein homolog;STRA13
- Extra Details:
- Enables DNA binding activity. Contributes to double-stranded DNA binding activity. Involved in replication fork processing and resolution of meiotic recombination intermediates. Part of FANCM-MHF complex and Fanconi anaemia nuclear complex.
- Shipping Conditions:
- Blue Ice