A9886
NLRP5 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9886
- Additional Names:
- CLR19.8|MATER|NALP5|NLRP5|PAN11|PYPAF8
- Application:
- ELISA, WB
- Molecular Weight:
- 134kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TMTDQGPSKEKVPGISQAVQQDSATAAETKEQEISQAMEQEGATAAETEEQEISQAMEQEGATAAETEEQGHGGDTWDYKSHVMTKFAEEEDVRRSFENT
- Uniprot:
- P59047
- Synonyms:
- CLR19.8;MATER;mater protein homolog;maternal antigen that embryos require;NACHT, leucine rich repeat and PYD containing 5;NACHT, LRR and PYD domains-containing protein 5;NALP5;nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 5;PAN11;PYPAF8
- Extra Details:
- The protein encoded by this gene belongs to the NALP protein family. Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). Expression of this gene is restricted to the oocyte. A mouse gene that encodes a maternal oocyte protein, similar to this encoded protein, is required for normal early embryogenesis.
- Shipping Conditions:
- Blue Ice