CLEC7A Rabbit polyclonal antibody

Size

£151.00

SKU:: A9883
Additional Names:: BGR|CANDF4|CD369|CLEC7A|CLECSF12|DECTIN1|SCARE2
Application:: ELISA, WB
Molecular Weight:: 22 kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSI
Uniprot:: Q9BXN2
Synonyms:: beta-glucan receptor;BGR;C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12;C-type lectin domain family 7 member A;C-type lectin superfamily member 12;CANDF4;CD369;CLECSF12;DC-associated C-type lectin 1;dectin-1;DECTIN1;Dendritic cell-associated C-type lectin 1;dendritic cell-associated C-type lectin-1;lectin-like receptor 1;SCARE2
Extra Details:: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.

Shipping Conditions:: Blue Ice