A9881
ANKH Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9881
- Additional Names:
- ANK|ANKH|CCAL2|CMDJ|CPPDD|HANK|MANK|SLC62A1
- Application:
- ELISA, WB
- Molecular Weight:
- 54kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LGYYKNIHDIIPDRSGPELGGDATIRKMLSFWWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVYPAFDKNNPSNKLVSTSNTVT
- Uniprot:
- Q9HCJ1
- Synonyms:
- ANK;ankylosis, progressive homolog;CCAL2;CMDJ;CPPDD;HANK;MANK;progressive ankylosis protein homolog;SLC62A1
- Extra Details:
- This gene encodes a multipass transmembrane protein that is expressed in joints and other tissues and controls pyrophosphate levels in cultured cells. Progressive ankylosis-mediated control of pyrophosphate levels has been suggested as a possible mechanism regulating tissue calcification and susceptibility to arthritis in higher animals. Mutations in this gene have been associated with autosomal dominant craniometaphyseal dysplasia.
- Shipping Conditions:
- Blue Ice