ZFPM2 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9868
Additional Names:: DIH3|FOG2|hFOG-2|SRXY9|ZC2HC11B|ZFPM2|ZNF89B
Application:: ELISA, WB
Molecular Weight:: 150kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQASSNGCAALKKDSLPLLPKNRGMVIVNGGLKQDERPAANPQQENISQNPQHEDDHKSPSWISENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKYCRLCDIQFNNLSNFITHKKFYCSSHAAEHVK
Uniprot:: Q8WW38
Synonyms:: DIH3;FOG-2;FOG2;friend of GATA 2;friend of GATA protein 2;Friend of GATA2;hFOG-2;SRXY9;transcription factor GATA4, modulator of;ZC2HC11B;zinc finger protein 89B;Zinc finger protein multitype 2;zinc finger protein ZFPM2;zinc finger protein, multitype 2;ZNF89B
Extra Details:: The zinc finger protein encoded by this gene is a widely expressed member of the FOG family of transcription factors. The family members modulate the activity of GATA family proteins, which are important regulators of hematopoiesis and cardiogenesis in mammals. It has been demonstrated that the protein can both activate and down-regulate expression of GATA-target genes, suggesting different modulation in different promoter contexts. A related mRNA suggests an alternatively spliced product but this information is not yet fully supported by the sequence.

Shipping Conditions:: Blue Ice