A9864
CCL27 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9864
- Additional Names:
- ALP|CCL27|CTACK|CTAK|ESKINE|ILC|PESKY|SCYA27
- Application:
- ELISA, WB
- Molecular Weight:
- 16kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
- Uniprot:
- Q9Y4X3
- Synonyms:
- ALP;C-C motif chemokine 27;CC chemokine ILC;chemokine (C-C motif) ligand 27;CTACK;CTAK;cutaneous T-cell attracting chemokine;Cutaneous T-cell-attracting chemokine;ESKINE;IL-11 R-alpha-locus chemokine;IL-11 Ralpha-locus chemokine;ILC;PESKY;SCYA27;skinkine;small inducible cytokine subfamily A (Cys-Cys), member 27;small-inducible cytokine A27
- Extra Details:
- This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation.
- Shipping Conditions:
- Blue Ice