A9841
RPE65 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9841
- Additional Names:
- BCO3|LCA2|mRPE65|p63|rd12|RP20|RPE65|sRPE65
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 65kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS
- Uniprot:
- Q16518
- Synonyms:
- all-trans-retinyl-palmitate hydrolase;BCO family, member 3;BCO3;LCA2;lutein isomerase;meso-zeaxanthin isomerase;mRPE65;p63;RBP-binding membrane protein;rd12;retinal pigment epithelium specific protein 65;retinal pigment epithelium-specific 65 kDa protein;retinal pigment epithelium-specific protein 65kDa;retinitis pigmentosa 20 (autosomal recessive);retinoid isomerohydrolase;retinol isomerase;RP20;RPE65, retinoid isomerohydrolase;sRPE65
- Extra Details:
- The protein encoded by this gene is a component of the vitamin A visual cycle of the retina which supplies the 11-cis retinal chromophore of the photoreceptors opsin visual pigments. It is a member of the carotenoid cleavage oxygenase superfamily. All members of this superfamily are non-heme iron oxygenases with a seven-bladed propeller fold and oxidatively cleave carotenoid carbon:carbon double bonds. However, the protein encoded by this gene has acquired a divergent function that involves the concerted O-alkyl ester cleavage of its all-trans retinyl ester substrate and all-trans to 11-cis double bond isomerization of the retinyl moiety. As such, it performs the essential enzymatic isomerization step in the synthesis of 11-cis retinal. Mutations in this gene are associated with early-onset severe blinding disorders such as Leber congenital.
- Shipping Conditions:
- Blue Ice