A9831
NDUFA6 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9831
- Additional Names:
- B14|CI-B14|LYRM6|MC1DN33|NADHB14|NDUFA6
- Application:
- ELISA, WB
- Molecular Weight:
- 13kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP
- Uniprot:
- P56556
- Synonyms:
- B14;CI-B14;Complex I-B14;LYR motif-containing protein 6;LYRM6;MC1DN33;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6;NADH-ubiquinone oxidoreductase 1 alpha subcomplex, 6;NADH-ubiquinone oxidoreductase B14 subunit;NADHB14
- Extra Details:
- This gene encodes a member of the LYR family of proteins that contain a highly conserved tripeptide (LYR) motif near the N-terminus. The encoded protein is an accessory subunit of NADH: ubiquinone oxidorerductase (Complex I), which is the largest enzyme of the mitochondrial membrane respiratory chain. Complex I functions in electron transfer from NADH to the respiratory chain.
- Shipping Conditions:
- Blue Ice