A9818
GNGT2 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9818
- Additional Names:
- G-GAMMA-8|G-GAMMA-C|GNG9|GNGT2|GNGT8|HG3I
- Application:
- ELISA, WB
- Molecular Weight:
- 14kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
- Uniprot:
- O14610
- Synonyms:
- g gamma-C;G protein cone gamma 8 subunit;G-GAMMA-8;G-gamma-9;G-GAMMA-C;gamma-T2 subunit;GNG9;GNGT8;guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2;guanine nucleotide binding protein gamma 9;guanine nucleotide binding protein gamma transducing activity polypeptide 2;guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
- Extra Details:
- Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene.
- Shipping Conditions:
- Blue Ice