NY-ESO-1 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9810
Additional Names:: CT6.1|CTAG|CTAG1|ESO1|LAGE-2|LAGE2B|NY-ESO-1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 20kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPM
Uniprot:: P78358
Synonyms:: autoimmunogenic cancer/testis antigen NY-ESO-1;cancer antigen 3;cancer/testis antigen 1;cancer/testis antigen 1-A;cancer/testis antigen 6.1;CT6.1;CTAG;CTAG1;ESO1;l antigen family member 2;LAGE-2;LAGE2A;LAGE2B;New York esophageal squamous cell carcinoma 1;NY-ESO-1
Extra Details:: The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence.