CDC34 Rabbit monoclonal antibody

Size

POA

SKU:: A9772
Additional Names:: CDC34|E2-CDC34|UBC3|UBCH3|UBE2R1
Application:: ELISA, WB
Molecular Weight:: 32 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
Uniprot:: P49427
Synonyms:: (E3-independent) E2 ubiquitin-conjugating enzyme R1;cell division cycle 34 homolog;E2 ubiquitin-conjugating enzyme R1;E2-CDC34;UBC3;UBCH3;UBE2R1;ubiquitin carrier protein;ubiquitin-conjugating enzyme E2 R1;ubiquitin-conjugating enzyme E2-32 KDA complementing;ubiquitin-conjugating enzyme E2-CDC34;ubiquitin-protein ligase R1
Extra Details:: The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication.