A9758
CDC25B Rabbit monoclonal antibody

Size
POA
- SKU:
- A9758
- Additional Names:
- CDC25B|cell division cycle 25B
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 65kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFK
- Uniprot:
- P30305
- Synonyms:
- CDC25 homolog B;dual specificity phosphatase Cdc25B;M-phase inducer phosphatase 2
- Extra Details:
- CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist.
- Shipping Conditions:
- Blue Ice



