A9755
ACVRL1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A9755
- Additional Names:
- ACVRL1|ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 62kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VLWEIARRTIVNGIVEDYRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKISNSPEKPKVIQ
- Uniprot:
- P37023
- Synonyms:
- activin A receptor type II-like 1;activin A receptor type IL;activin A receptor, type II-like kinase 1;Activin receptor-like kinase 1;ACVRLK1;ALK-1;ALK1;HHT;HHT2;ORW2;serine/threonine-protein kinase receptor R3;SKR3;TGF-B superfamily receptor type I;TSR-I
- Extra Details:
- This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2.
- Shipping Conditions:
- Blue Ice