A9722
GRIK2 Rabbit monoclonal antibody

Size
POA
- SKU:
- A9722
- Additional Names:
- EAA4|GLR6|GluK2|GLUK6|GLUR6|GRIK2|MRT6|NEDLAS
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY
- Uniprot:
- Q13002
- Synonyms:
- bA487F5.1;EAA4;excitatory amino acid receptor 4;GLR6;GluK2;GluK2(alt_5'UTR);GLUK6;gluR-6;GLUR6;glutamate receptor 6;glutamate receptor form A;glutamate receptor form B;glutamate receptor form C;glutamate receptor form D;glutamate receptor form E;glutamate receptor ionotropic, kainate 2;MRT6;putative NMDtranscript(cassette_171nt)
- Extra Details:
- Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. Mutations in this gene have been associated with autosomal recessive cognitive disability.
- Shipping Conditions:
- Blue Ice







