GATAD2B Rabbit polyclonal antibody

Size

£151.00

SKU:: A9716
Additional Names:: GANDS|GATAD2B|MRD18|P66beta|p68
Application:: ELISA, WB, IHC-P, IP
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLT
Uniprot:: Q8WXI9
Synonyms:: GANDS;GATA zinc finger domain-containing protein 2B;MRD18;p66/p68;P66beta;p68;transcription repressor p66 beta component of the MeCP1 complex;transcriptional repressor p66-beta
Extra Details:: This gene encodes a zinc finger protein transcriptional repressor. The encoded protein is part of the methyl-CpG-binding protein-1 complex, which represses gene expression by deacetylating methylated nucleosomes. Mutations in this gene are linked to intellectual disability and dysmorphic features associated with cognitive disability.