A9663
TIRAP Rabbit monoclonal antibody

Size
POA
- SKU:
- A9663
- Additional Names:
- BACTS1|Mal|MyD88-2|TIRAP|wyatt
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 32kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAA
- Uniprot:
- P58753
- Synonyms:
- adapter protein wyatt;adaptor protein Wyatt;BACTS1;Mal;MyD88 adapter-like protein;MyD88-2;toll-interleukin 1 receptor (TIR) domain containing adaptor protein;Toll-like receptor adaptor protein;toll/interleukin-1 receptor domain-containing adapter protein;wyatt
- Extra Details:
- The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleukin 1 receptor (TIR) domain, which is responsible for signal transduction. The protein encoded by this gene is a TIR adaptor protein involved in the TLR4 signaling pathway of the immune system. It activates NF-kappa-B, MAPK1, MAPK3 and JNK, which then results in cytokine secretion and the inflammatory response. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.
- Shipping Conditions:
- Blue Ice





