PRP19 Rabbit monoclonal antibody

Size

POA

SKU:: A9660
Additional Names:: hPSO4|NMP200|PRP19|PSO4|SNEV|UBOX4
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL
Uniprot:: Q9UMS4
Synonyms:: hPSO4;NMP200;nuclear matrix protein 200;nuclear matrix protein NMP200 related to splicing factor PRP19;pre-mRNA-processing factor 19;PRP19;PRP19/PSO4 homolog;PRP19/PSO4 pre-mRNA processing factor 19 homolog;PSO4;psoralen 4;RING-type E3 ubiquitin transferase PRP19;senescence evasion factor;SNEV;UBOX4
Extra Details:: Enables identical protein binding activity and ubiquitin-ubiquitin ligase activity. Involved in several processes, including DNA damage checkpoint signaling; cellular protein metabolic process; and mRNA splicing, via spliceosome. Acts upstream of or within protein polyubiquitination. Located in cytoplasm; nuclear speck; and site of double-strand break. Part of Prp19 complex and U2-type catalytic step 2 spliceosome. Colocalizes with DNA replication factor A complex.