A9652
CARD11 Rabbit monoclonal antibody
Size
POA
- SKU:
- A9652
- Additional Names:
- BENTA|BIMP3|CARD11|CARMA1|IMD11|IMD11A|PPBL
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 150kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL
- Uniprot:
- Q9BXL7
- Synonyms:
- bcl10-interacting maguk protein 3;BENTA;BIMP3;CARD-containing MAGUK protein 1;carma 1;CARMA1;caspase recruitment domain-containing protein 11;IMD11;IMD11A;PPBL
- Extra Details:
- The protein encoded by this gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein has a domain structure similar to that of CARD14 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10.
- Shipping Conditions:
- Blue Ice