A9643
GNB2 Rabbit monoclonal antibody

Size
POA
- SKU:
- A9643
- Additional Names:
- GNB2|HG2C1|NEDHYDF|SSS4
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKV
- Uniprot:
- P62879
- Synonyms:
- epididymis secretory sperm binding protein;g protein subunit beta-2;G protein, beta-2 subunit;guanine nucleotide binding protein (G protein), beta polypeptide 2;guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2;guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2;signal-transducing guanine nucleotide-binding regulatory protein beta subunit;SSS4;SSS4; NEDHYDF;transducin beta chain 2
- Extra Details:
- Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR.
- Shipping Conditions:
- Blue Ice



