UBQLN2 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9568
Additional Names:: ALS15|CHAP1|DSK2|HRIHFB2157|N4BP4|PLIC2|UBQLN2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNSNPFGLGSLGG
Uniprot:: Q9UHD9
Synonyms:: ALS15;CHAP1;DSK2;DSK2 homolog;HRIHFB2157;N4BP4;Nedd4 binding protein 4;PLIC2;protein linking IAP with cytoskeleton 2;ubiquilin-2;ubiquitin-like product Chap1/Dsk2
Extra Details:: This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases; and thus, are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein.