A9562
CYP2D6 Rabbit monoclonal antibody

Size
POA
- SKU:
- A9562
- Additional Names:
- CPD6|CYP2D|CYP2D6|CYP2D7AP|CYP2D7BP|CYP2D7P2|CYP2D8P2|CYP2DL1|CYPIID6|P450-DB1|P450C2D|P450DB1
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 50 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR
- Uniprot:
- P10635
- Synonyms:
- cholesterol 25-hydroxylase;CPD6;CYP2D;CYP2D7AP;CYP2D7BP;CYP2D7P2;CYP2D8P2;CYP2DL1;CYPIID6;cytochrome P450 2D6;cytochrome P450-DB1;cytochrome P450, family 2, subfamily D, polypeptide 6;cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2;cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2;cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), polypeptide 7 pseudogene 2;cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), polypeptide 8 pseudogene 2;cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)-like 1;cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), polypeptide 6;debrisoquine 4-hydroxylase;flavoprotein-linked monooxygenase;microsomal monooxygenase;nonfunctional cytochrome P450 2D6;P450-DB1;P450C2D;P450DB1;xenobiotic monooxygenase
- Extra Details:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 25% of commonly prescribed drugs. Its substrates include antidepressants, antipsychotics, analgesics and antitussives, beta adrenergic blocking agents, antiarrythmics and antiemetics. The gene is highly polymorphic in the human population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. Some individuals with the poor metabolizer phenotype have no functional protein since they carry 2 null alleles whereas in other individuals the gene is absent. This gene can vary in copy number and individuals with the ultrarapid metabolizer phenotype can have 3 or more active copies of the gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice







