A9559
MEPE Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9559
- Additional Names:
- MEPE|OF45
- Application:
- ELISA, WB
- Molecular Weight:
- 58kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FTNRQRLNKEYSISNKENTHNGLRMSIYPKSTGNKGFEDGDDAISKLHDQEEYGAALIRNNMQHIMGPVTAIKLLGEENKENTPRNVLNIIPASMNYAKAHSKDKKKPQRDSQAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQERGDNDISPFS
- Uniprot:
- Q9NQ76
- Synonyms:
- matrix extracellular phosphoglycoprotein;matrix, extracellular phosphoglycoprotein with ASARM motif (bone);OF45;osteoblast/osteocyte factor 45;osteoregulin
- Extra Details:
- This gene encodes a secreted calcium-binding phosphoprotein that belongs to the small integrin-binding ligand, N-linked glycoprotein (SIBLING) family of proteins. Members of this family are components of the extracellular matrix of bone and dentin and regulate bone mineralization. Deficiency of a similar protein in mouse results in increased bone mass. Mice lacking this gene are resistant to aging-related trabecular bone loss. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice