A9547
PSMA/FOLH1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A9547
- Additional Names:
- FGCP|FOLH|GCP2|GCPII|mGCP|NAALAD1|PSM|PSMA|PSMA/FOLH1
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLD
- Uniprot:
- Q04609
- Synonyms:
- cell growth-inhibiting gene 27 protein;FGCP;Folate hydrolase 1;FOLH;folylpoly-gamma-glutamate carboxypeptidase;GCP2;GCPII;glutamate carboxylase II;glutamate carboxypeptidase 2;glutamate carboxypeptidase II;membrane glutamate carboxypeptidase;mGCP;N-acetylated alpha-linked acidic dipeptidase 1;N-acetylated-alpha-linked acidic dipeptidase I;NAALAD1;NAALADase I;prostate specific membrane antigen variant F;Prostate-specific membrane antigen;PSM;PSMA;pteroylpoly-gamma-glutamate carboxypeptidase
- Extra Details:
- This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms.
- Shipping Conditions:
- Blue Ice