A9536
ZAP70 Rabbit monoclonal antibody

Size
POA
- SKU:
- A9536
- Additional Names:
- ADMIO2|IMD48|SRK|STCD|STD|TZK|ZAP-70|ZAP70
- Application:
- ELISA, WB
- Molecular Weight:
- 73kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGPPGSTQKAEAACA
- Uniprot:
- P43403
- Synonyms:
- 70 kDa zeta-associated protein;70 kDa zeta-chain associated protein;ADMIO2;IMD48;SRK;STCD;STD;syk-related tyrosine kinase;tyrosine-protein kinase ZAP-70;TZK;ZAP-70;zeta chain of T cell receptor associated protein kinase 70kDa;zeta-chain (TCR) associated protein kinase 70kDa;zeta-chain associated protein kinase, 70kD
- Extra Details:
- This gene encodes an enzyme belonging to the protein tyrosine kinase family, and it plays a role in T-cell development and lymphocyte activation. This enzyme, which is phosphorylated on tyrosine residues upon T-cell antigen receptor (TCR) stimulation, functions in the initial step of TCR-mediated signal transduction in combination with the Src family kinases, Lck and Fyn. This enzyme is also essential for thymocyte development. Mutations in this gene cause selective T-cell defect, a severe combined immunodeficiency disease characterized by a selective absence of CD8-positive T-cells. Two transcript variants that encode different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice



