ITIH3 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9459
Additional Names:: H3P|ITI-HC3|ITIH3|SHAP
Application:: ELISA, WB
Molecular Weight:: 105kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LPEGVANGIEVYSTKINSKVTSRFAHNVVTMRAVNRADTAKEVSFDVELPKTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVSQGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVK
Uniprot:: Q06033
Synonyms:: H3P;inter-alpha (globulin) inhibitor H3;inter-alpha (globulin) inhibitor, H3 polypeptide;inter-alpha-inhibitor heavy chain 3;inter-alpha-trypsin inhibitor heavy chain H3;ITI heavy chain H3;ITI-HC3;pre-alpha (globulin) inhibitor, H3 polypeptide;serum-derived hyaluronan-associated protein;SHAP
Extra Details:: This gene encodes the heavy chain subunit of the pre-alpha-trypsin inhibitor complex. This complex may stabilize the extracellular matrix through its ability to bind hyaluronic acid. Polymorphisms of this gene may be associated with increased risk for schizophrenia and major depressive disorder. This gene is present in an inter-alpha-trypsin inhibitor family gene cluster on chromosome 3.