TNPO1 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9435
Additional Names:: IPO2|KPNB2|MIP|MIP1|TNPO1|TRN
Application:: ELISA, WB
Molecular Weight:: 85-102kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: CPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKE
Uniprot:: Q92973
Synonyms:: importin 2;importin beta 2;Importin beta-2;IPO2;karyopherin (importin) beta 2;karyopherin beta-2;KPNB2;M9 region interaction protein;MIP;MIP1;transportin-1;TRN
Extra Details:: This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in several transcript variants encoding different proteins.