A9433
HECTD1 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9433
- Additional Names:
- EULIR|HECTD1
- Application:
- ELISA, WB
- Molecular Weight:
- 300kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN
- Uniprot:
- Q9ULT8
- Synonyms:
- E3 ligase for inhibin receptor;E3 ubiquitin-protein ligase HECTD1;EULIR;HECT domain containing E3 ubiquitin protein ligase 1;HECT domain-containing protein 1;HECT-type E3 ubiquitin transferase HECTD1
- Extra Details:
- Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in anatomical structure development; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; and protein K63-linked ubiquitination. Predicted to act upstream of or within several processes, including animal organ development; negative regulation of protein localization to plasma membrane; and protein autoubiquitination.
- Shipping Conditions:
- Blue Ice