A9409
Kallikrein 8 Rabbit monoclonal antibody
Size
POA
- SKU:
- A9409
- Additional Names:
- HNP|Kallikrein 8|NP|NRPN|PRSS19|TADG14
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
- Uniprot:
- O60259
- Synonyms:
- HNP;kallikrein-8;Neuropsin;NP;NRPN;ovasin;PRSS19;serine protease 19;serine protease TADG-14;TADG14;tumor-associated differentially expressed gene 14 protein
- Extra Details:
- Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice