A9406
MMUT Rabbit monoclonal antibody

Size
POA
- SKU:
- A9406
- Additional Names:
- MCM|MMUT|MUT
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 83kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMY
- Uniprot:
- P22033
- Synonyms:
- MCM;methylmalonyl Coenzyme A mutase;methylmalonyl-CoA isomerase;methylmalonyl-CoA mutase c.*192delA;methylmalonyl-CoA mutase c.*51C>G;methylmalonyl-CoA mutase variant c.1495G>A;methylmalonyl-CoA mutase variant c.2011A>G;methylmalonyl-CoA mutase variant c.2150G>T;methylmalonyl-CoA mutase variant c.322C>T;methylmalonyl-CoA mutase variant c.613_615delGAA;methylmalonyl-CoA mutase variant c.636G>A;methylmalonyl-CoA mutase variant c.643G>A;methylmalonyl-CoA mutase, mitochondrial;MUT;mutant methylmalonyl CoA mutase;truncated methylmalonyl CoA mutase;truncated methylmalonyl-CoA mutase variant c.1420C>T;truncated methylmalonyl-CoA mutase variant c.2179C>T;truncated methylmalonyl-CoA mutase variant c.91C>T
- Extra Details:
- This gene encodes the mitochondrial enzyme methylmalonyl Coenzyme A mutase. In humans, the product of this gene is a vitamin B12-dependent enzyme which catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA, while in other species this enzyme may have different functions. Mutations in this gene may lead to various types of methylmalonic aciduria.
- Shipping Conditions:
- Blue Ice







