A9396
THRAP3 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9396
- Additional Names:
- BCLAF2|THRAP3|TRAP150
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 150kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GGAAYTKRYLEEQKTENGKDKEQKQTNTDKEKIKEKGSFSDTGLGDGKMKSDSFAPKTDSEKPFRGSQSPKRYKLRDDFEKKMADFHKEEMDDQDKDKAKGRKESEFDDEPKFMSKVIGANKNQEEEKSGKWEGLVYAPPGKEKQRKTEELEEESFPERSK
- Uniprot:
- Q9Y2W1
- Synonyms:
- BCLAF1 and THRAP3 family member 2;BCLAF2;thyroid hormone receptor-associated protein 3;thyroid hormone receptor-associated protein complex 150 kDa component;thyroid hormone receptor-associated protein, 150 kDa subunit;TR-associated protein, 150-kDa;TRAP150
- Extra Details:
- Enables phosphoprotein binding activity; thyroid hormone receptor binding activity; and transcription coactivator activity. Involved in nuclear-transcribed mRNA catabolic process; positive regulation of circadian rhythm; and regulation of RNA metabolic process. Acts upstream of or within positive regulation of transcription by RNA polymerase II. Located in nuclear speck. Part of mediator complex. Colocalizes with exon-exon junction complex.
- Shipping Conditions:
- Blue Ice