SR protein repeat Rabbit monoclonal antibody

Size

POA

SKU:: A9377
Additional Names:: B52|HEL-S-91|SFRS6|SR protein repeat|SRP55
Application:: ELISA, WB, IHC-P, IP
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRS
Uniprot:: Q13247
Synonyms:: B52;epididymis secretory protein Li 91;HEL-S-91;pre-mRNA-splicing factor SRP55;serine/arginine-rich splicing factor 6;SFRS6;Splicing factor, arginine/serine-rich 6;splicing factor, arginine/serine-rich, 55 kDa;SR splicing factor 6;SRP55
Extra Details:: The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. Alternative splicing results in multiple transcript variants. In addition, two pseudogenes, one on chromosome 17 and the other on the X chromosome, have been found for this gene.