A9376
EGFL7 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9376
- Additional Names:
- EGFL7|NEU1|VE-STATIN|ZNEU1
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPG
- Uniprot:
- Q9UHF1
- Synonyms:
- EGF-like protein 7;epidermal growth factor-like protein 7;multiple EGF-like domains protein 7;multiple epidermal growth factor-like domains protein 7;NEU1;NOTCH4-like protein;vascular endothelial statin;VE-STATIN;ZNEU1
- Extra Details:
- This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice