LINGO1 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9369
Additional Names:: LERN1|LINGO1|LRRN6A|MRT64|UNQ201
Application:: ELISA, WB
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: CPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYR
Uniprot:: Q96FE5
Synonyms:: LERN1;leucine rich repeat neuronal 6A;leucine-rich repeat and immunoglobulin domain-containing protein 1;leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1;leucine-rich repeat neuronal protein 1;Leucine-rich repeat neuronal protein 6A;LRRN6A;MRT64;UNQ201
Extra Details:: Predicted to enable epidermal growth factor receptor binding activity. Predicted to act upstream of or within generation of neurons and protein kinase B signaling. Predicted to be located in plasma membrane. Predicted to be active in extracellular matrix and extracellular space. Implicated in autosomal recessive non-syndromic intellectual disability and glaucoma.