MUTA Rabbit monoclonal antibody

Size

POA

SKU:: A9339
Additional Names:: MCM|MUT|MUTA
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 83kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSA
Uniprot:: P22033
Synonyms:: MCM;methylmalonyl Coenzyme A mutase;methylmalonyl-CoA isomerase;methylmalonyl-CoA mutase c.*192delA;methylmalonyl-CoA mutase c.*51C>G;methylmalonyl-CoA mutase variant c.1495G>A;methylmalonyl-CoA mutase variant c.2011A>G;methylmalonyl-CoA mutase variant c.2150G>T;methylmalonyl-CoA mutase variant c.322C>T;methylmalonyl-CoA mutase variant c.613_615delGAA;methylmalonyl-CoA mutase variant c.636G>A;methylmalonyl-CoA mutase variant c.643G>A;methylmalonyl-CoA mutase, mitochondrial;MUT;mutant methylmalonyl CoA mutase;truncated methylmalonyl CoA mutase;truncated methylmalonyl-CoA mutase variant c.1420C>T;truncated methylmalonyl-CoA mutase variant c.2179C>T;truncated methylmalonyl-CoA mutase variant c.91C>T
Extra Details:: This gene encodes the mitochondrial enzyme methylmalonyl Coenzyme A mutase. In humans, the product of this gene is a vitamin B12-dependent enzyme which catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA, while in other species this enzyme may have different functions. Mutations in this gene may lead to various types of methylmalonic aciduria.

Shipping Conditions:: Blue Ice