A9320
NCTR2 Rabbit monoclonal antibody

Size
POA
- SKU:
- A9320
- Additional Names:
- CD336|dJ149M18.1|LY95|NCTR2|NK-p44|NKP44
- Application:
- ELISA, WB
- Molecular Weight:
- 44kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLR
- Uniprot:
- O95944
- Synonyms:
- CD336;dJ149M18.1;LY95;lymphocyte antigen 95 (activating NK-receptor; NK-p44);Lymphocyte antigen 95 homolog;lymphocyte antigen 95 homolog (activating NK-receptor; NK-p44);natural cytotoxicity triggering receptor 2;natural killer cell p44-related protein;NK cell activating receptor (NKp44);NK cell-activating receptor;NK-p44;NKP44
- Extra Details:
- Predicted to enable signaling receptor activity. Predicted to be involved in cellular defense response and signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane. Predicted to be active in cell surface.
- Shipping Conditions:
- Blue Ice

