STXBP1 Rabbit monoclonal antibody

Size

POA

SKU:: A9309
Additional Names:: DEE4|MUNC18-1|N-Sec1|NSEC1|P67|RBSEC1|STXBP1|unc-18A|UNC18|unc18-1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 70 kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: STYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYP
Uniprot:: P61764
Synonyms:: DEE4;MUNC18-1;N-Sec1;neuronal SEC1;NSEC1;P67;protein unc-18 homolog 1;protein unc-18 homolog A;RBSEC1;syntaxin-binding protein 1;unc-18A;UNC18;unc18-1
Extra Details:: This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.