A9300
CORO1A Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A9300
- Additional Names:
- CLABP|CLIPINA|CORO1A|HCORO1|IMD8|p57|TACO
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 51kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
- Uniprot:
- P31146
- Synonyms:
- CLABP;clipin-A;CLIPINA;coronin-1;coronin-1A;coronin-like protein A;coronin-like protein p57;coronin, actin binding protein, 1A;HCORO1;IMD8;p57;TACO;tryptophan aspartate-containing coat protein
- Extra Details:
- This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. A related pseudogene has been defined on chromosome 16.
- Shipping Conditions:
- Blue Ice







