A9278
VPS35 Rabbit monoclonal antibody
Size
POA
- SKU:
- A9278
- Additional Names:
- MEM3|PARK17|VPS35
- Application:
- ELISA, WB
- Molecular Weight:
- 92kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQ
- Uniprot:
- Q96QK1
- Synonyms:
- hVPS35;maternal-embryonic 3;MEM3;PARK17;vacuolar protein sorting 35 homolog;vacuolar protein sorting-associated protein 35;Vesicle protein sorting 35
- Extra Details:
- This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex.
- Shipping Conditions:
- Blue Ice