FOXO3A Rabbit monoclonal antibody

Size

POA

SKU:: A9270
Additional Names:: AF6q21|FKHRL1|FKHRL1P2|FOXO2|FOXO3A
Application:: ELISA, WB
Molecular Weight:: 90kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG
Uniprot:: O43524
Synonyms:: AF6q21;AF6q21 protein;FKHRL1;FKHRL1P2;forkhead box O3A;forkhead box protein O3;forkhead homolog (rhabdomyosarcoma) like 1;forkhead in rhabdomyosarcoma-like 1;forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1;FOXO2;FOXO3A;FOXO3A-
Extra Details:: This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.