UBA1 Rabbit monoclonal antibody

Size

POA

SKU:: A9254
Additional Names:: A1S9|A1S9T|A1ST|AMCX1|CFAP124|GXP1|POC20|SMAX2|UBA1|UBA1A|UBE1|UBE1X|VEXAS
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 110-118kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR
Uniprot:: P22314
Synonyms:: A1S9;A1S9T;A1S9T and BN75 temperature sensitivity complementing;A1ST;AMCX1;CFAP124;GXP1;POC20;POC20 centriolar protein homolog;Protein A1S9;SMAX2;testicular secretory protein Li 63;UBA1, ubiquitin-activating enzyme E1 homolog A;UBA1A;UBE1;UBE1X;Ubiquitin-activating enzyme E1;ubiquitin-like modifier-activating enzyme 1;VEXAS
Extra Details:: The protein encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described.