A9227
C1QC Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9227
- Additional Names:
- C1Q-C|C1QC|C1QD3|C1QG
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 26kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGD
- Uniprot:
- P02747
- Synonyms:
- C1Q-C;C1QG;complement C1q subcomponent subunit C;complement component 1, q subcomponent, C chain;complement component 1, q subcomponent, gamma polypeptide
- Extra Details:
- This gene encodes the C-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis.
- Shipping Conditions:
- Blue Ice